Trematomus bernacchii (emerald rockcod): 117495537 Help Entry 117495537         CDS       T09643                                  Name (RefSeq) ras-related protein Rab-5C-like   KO K07888   Ras-related protein Rab-5B Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04137   Mitophagy - animal tben04144   Endocytosis tben04145   Phagosome tben04148   Efferocytosis tben05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tben00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117495537    04145 Phagosome     117495537    04137 Mitophagy - animal     117495537    04148 Efferocytosis     117495537  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117495537  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tben04131]     117495537   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117495537    04031 GTP-binding proteins [BR:tben04031]     117495537 Membrane trafficking [BR:tben04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     117495537  Endosome - Lysosome transport     117495537 Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117495537   Exosomal proteins of other body fluids (saliva and urine)    117495537   Exosomal proteins of colorectal cancer cells    117495537   Exosomal proteins of melanoma cells    117495537 GTP-binding proteins [BR:tben04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     117495537 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SDR-like Gtr1_RagA RsgA_GTPase B12-binding Tfb2_C DUF5793 Motif Other DBs NCBI-GeneID:  117495537 NCBI-ProteinID:  XP_034002704 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MLKFVFMQPLNNAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDI TKPDTFERAKAWVKELQRQASPNIVIALAGNKADLAERRLVEYEDAQTYAEDTGLLFMET SAKTAMNVNELFLAIAKKMPKTDTQNPTHAARHRGVNLQDPDAHSNRACCGGN NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgctcaaattcgtgttcatgcagcccctaaataatgcggcgttcctggctcagtcggtg tgtttagacgacaccacggtgaagtttgagatctgggacacggcgggacaggagcgctac cacagcctcgcccccatgtactacagaggagctcaggccgccatcgtggtcttcgacatc accaagccggacacctttgagcgagcgaaggcctgggtgaaggagctgcagaggcaggcc agtcccaacatcgtgatcgctctggctgggaacaaggcggacctggcagagaggagacta gtggagtacgaggacgcccagacgtacgctgaagacaccggcttgctcttcatggagacc tctgctaaaacagccatgaacgtcaatgagctcttcctggctattgcaaaaaagatgcca aaaacagacacccagaaccccacacatgcagcgcgacaccggggagtgaacctccaggat ccggacgcccactccaaccgagcctgctgcggggggaactaa

DBGET integrated database retrieval system