Trematomus bernacchii (emerald rockcod): 117500254 Help Entry 117500254         CDS       T09643                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04140   Autophagy - animal tben04150   mTOR signaling pathway tben04218   Cellular senescence tben04910   Insulin signaling pathway tben05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     117500254 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117500254 (rheb)   09143 Cell growth and death    04218 Cellular senescence     117500254 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     117500254 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     117500254 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tben04031]     117500254 (rheb) GTP-binding proteins [BR:tben04031]  Small (monomeric) G-proteins   Ras Family    Rheb     117500254 (rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase AAA_14 Reovirus_M2 RhoGAP_pG1_pG2 STIV_penton_2nd ParE_toxin YebF Motif Other DBs NCBI-GeneID:  117500254 NCBI-ProteinID:  XP_034008950 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKTITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFRRMILEAEKMEGGVQPGKTS CSMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcacgaaaaattgccatcctcgggtacagatccgtaggaaagtcc tccttgaccattcagtttgttgaaggccagtttgtggattcctatgatccgacaatagaa aacacattcactaaaacgatcacaataaatggacaagagtatcatcttcagctggtcgac acagcaggacaggatgagtactctatcttcccacagacctactccatagatatcaacggt tacattctggtctattcagtcacatccaataaaagctttgaagttgtacaagttatccat gaaaaactattggacatggtgggaaaggttcaagttccaattatgctcgtcggaaacaag aacgacctacatatggagcgagtaatcagttgtgaagaaggaaaagcattagccgaatcc tggaacgctgccttcatggagtcctcagctaaagagaaccagacggctgtggaagttttc cggaggatgatccttgaggcagagaagatggaaggcggcgtgcaaccaggaaaaacttcc tgctccatgatgtag

DBGET integrated database retrieval system