Trematomus bernacchii (emerald rockcod): 117500406 Help Entry 117500406         CDS       T09643                                  Name (RefSeq) histone H2B 1/2   KO K11252   histone H2B Organism tben  Trematomus bernacchii (emerald rockcod) Brite KEGG Orthology (KO) [BR:tben00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tben03036]     117500406   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117500406 Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117500406 Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117500406 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID YscO-like Motif Other DBs NCBI-GeneID:  117500406 NCBI-ProteinID:  XP_034009222 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MKQVHPDTGISSKAMGIMNCFVSDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPG ELAKHAVSEGTKAVTKYTSSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaagcaggtccaccccgacaccggcatctcctccaaggccatgggcatcatgaactgc ttcgtgagcgacatctttgagcgcatcgccggtgaggcctctcgtctggctcactacaac aagcgctccaccatcacctccagggagatccagaccgctgtccgcctgctactccccgga gagctggctaaacacgccgtgtctgagggcaccaaggccgtgaccaagtacaccagctcc aagtaa

DBGET integrated database retrieval system