KEGG   Tetrapisispora blattae: TBLA_0A01940
Entry
TBLA_0A01940      CDS       T02489                                 
Symbol
TBLA0A01940
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04111  Cell cycle - yeast
tbl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TBLA_0A01940 (TBLA0A01940)
   04113 Meiosis - yeast
    TBLA_0A01940 (TBLA0A01940)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tbl03400]
    TBLA_0A01940 (TBLA0A01940)
DNA repair and recombination proteins [BR:tbl03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    TBLA_0A01940 (TBLA0A01940)
SSDB
Motif
Pfam: Rad9 DUF2956
Other DBs
NCBI-GeneID: 14493358
NCBI-ProteinID: XP_004177514
UniProt: I2GV43
LinkDB
Position
1:complement(469805..471604)
AA seq 599 aa
MSFRAVINNLENHNTWYRTLHVLSTISEELKFTITNEKIIITSLNSTDTSIYKITFLKNF
FDEYEFSPHDIIFGETGLKIITDQRLKQIYTYSFKINGNHLTTIFRKPDGDVISKSSLII
NNTTTCPESLVNRLLVHIDMESSIMKEYSPQFEPIQYDHIILDLKYKQDFLTVYGRKAES
ENALKKLQPKIVQIFIEVQEDLQNAIYKPETETSKRKRINPDEFTSDEEINFISCNQTLL
RNFLENCNSHVTEQVKFELTPYKFIITAFTKAVYGKNNDILRNVINMSNQFNVSNLEGHC
TFELGDASITTNNNMTTTKNGIKSRTFSLREFKNFLNIPLPSKNSINYQGTVNIWYCKNG
DPIFMEMKKPNVVMQLIQLTESDLENVVPKSNVFDKASKREVLLPPPQPATVKRVPSFND
MPLIKSRKPSHEKNLFVPDDEYSQEEPPLFNNQHETDNNNNTVMASYKTTQEEGSVIGDS
QLGMNASMSNTDLTININNQTTLANRSNTTIGWGVAPVSKVNDNSKEVDLGMERTRQKNM
LKKERLLFLRGLKRQNEAKQREREKKAKRMEEENVNTNDNDNENGFGPTQDDTMKGLFD
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgtcatttagagctgtcattaataatttagaaaatcataacacatggtatcgaacacta
catgttttatctactatcagtgaagaattaaaatttactataaccaatgaaaaaattata
attacatcacttaattccacagatacatcgatttataaaataacttttttaaaaaacttt
ttcgatgagtatgaattttcaccacatgatataatatttggtgagactggccttaagata
attactgatcaacgattaaaacaaatttatacatattcatttaaaatcaatgggaaccat
ttaaccacgatatttaggaaacctgatggcgatgtgatttccaaatcgtctcttataata
aataataccactacatgtccagaaagtttagttaatcgattattagttcatatagatatg
gaatcaagtattatgaaagaatattctccacaattcgaacccattcaatatgatcatatc
attttagatttgaaatataaacaagatttcttaacagtatatggacgtaaggctgaaagt
gagaatgccttgaagaaattacaacccaaaattgtgcaaatctttattgaagtacaagaa
gatttacaaaatgccatatataaacccgaaactgaaacatccaagaggaaacgaatcaat
cctgatgaattcacttcagacgaagagattaatttcatatcctgtaatcaaacgttatta
aggaatttcttggaaaattgtaattcccatgtcactgaacaagtgaaatttgaattaact
ccatataaatttatcattaccgcgttcactaaggctgtttatggtaagaataatgatata
ttaagaaatgtgattaatatgagtaatcaatttaatgtatctaatttggaaggtcattgt
acgtttgagttgggtgatgctagtattactacaaataataatatgacgacgacaaaaaac
ggtattaaatcaagaactttttcattaagagaatttaaaaatttcttaaatattccattg
cccagtaagaattctattaattaccaaggtacagttaacatctggtattgtaagaatgga
gatccaatctttatggaaatgaaaaagcccaatgtagtaatgcaattgattcaattgaca
gagagtgatttggaaaatgtggtacctaaatccaatgttttcgataaagcttccaaaaga
gaagtgcttcttcccccacctcaacctgccaccgtgaaaagggttccgtcatttaatgat
atgcctttaataaagagtcgtaaacctagtcatgaaaaaaatttatttgttcccgatgat
gaatattctcaagaagaaccaccattattcaacaatcaacacgagactgataataataat
aatactgtcatggcaagttacaagactacacaagaagagggaagtgtcattggagattct
caattggggatgaatgcgtcgatgagtaataccgatttgaccatcaatataaataatcaa
accacactagctaatagatcgaacactactatcggatggggggttgcgcctgtatctaaa
gtgaatgataattccaaagaggttgatcttggtatggaacgaacacgtcaaaagaatatg
ttaaagaaggaaagattattattcttacgaggattaaagagacagaatgaagctaaacaa
agggaaagggagaagaaagctaaacgaatggaagaagagaatgtcaatacaaatgacaat
gataatgaaaatggatttggaccaacacaagatgatacgatgaaagggttgtttgattga

DBGET integrated database retrieval system