Henningerozyma blattae: TBLA_0A03730 Help Entry TBLA_0A03730      CDS       T02489                                  Symbol TBLA0A03730 Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism tbl  Henningerozyma blattae Pathway tbl03050   Proteasome tbl03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tbl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     TBLA_0A03730 (TBLA0A03730)   09124 Replication and repair    03440 Homologous recombination     TBLA_0A03730 (TBLA0A03730)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tbl03019]     TBLA_0A03730 (TBLA0A03730)    04131 Membrane trafficking [BR:tbl04131]     TBLA_0A03730 (TBLA0A03730)    03051 Proteasome [BR:tbl03051]     TBLA_0A03730 (TBLA0A03730)    03400 DNA repair and recombination proteins [BR:tbl03400]     TBLA_0A03730 (TBLA0A03730) Messenger RNA biogenesis [BR:tbl03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      TBLA_0A03730 (TBLA0A03730) Membrane trafficking [BR:tbl04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     TBLA_0A03730 (TBLA0A03730) Proteasome [BR:tbl03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      TBLA_0A03730 (TBLA0A03730) DNA repair and recombination proteins [BR:tbl03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      TBLA_0A03730 (TBLA0A03730) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  14493132 NCBI-ProteinID:  XP_004177690 UniProt:  I2GVL9 LinkDB All DBs Position 1:934921..935196 Genome browser AA seq 91 aa AA seqDB search MSNTQEQTTTKPANEATKTSAVRRTLEEDDEFEDFPVDTWPENDTVKAALANDKTKNSNL WEEDWDDVEVEDDFTKELKAELDRHKQTQNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtaatacccaagaacaaaccactacaaagcctgcaaatgaagctacaaagacaagt gcagtaagacgcacattagaggaagatgacgaatttgaagattttccagtcgacacttgg ccagaaaatgacacagtaaaagccgcattggctaatgataaaaccaagaattcgaatcta tgggaagaagattgggatgacgttgaagtagaagatgattttaccaaggaattaaaggca gaattagatagacataagcaaacccaaaataattga

DBGET integrated database retrieval system