Henningerozyma blattae: TBLA_0C05090 Help Entry TBLA_0C05090      CDS       T02489                                  Symbol TBLA0C05090 Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism tbl  Henningerozyma blattae Pathway tbl03060   Protein export tbl04141   Protein processing in endoplasmic reticulum tbl04145   Phagosome Brite KEGG Orthology (KO) [BR:tbl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TBLA_0C05090 (TBLA0C05090)    04141 Protein processing in endoplasmic reticulum     TBLA_0C05090 (TBLA0C05090)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TBLA_0C05090 (TBLA0C05090)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tbl04131]     TBLA_0C05090 (TBLA0C05090)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tbl02044]     TBLA_0C05090 (TBLA0C05090) Membrane trafficking [BR:tbl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TBLA_0C05090 (TBLA0C05090) Secretion system [BR:tbl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TBLA_0C05090 (TBLA0C05090) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Tir_receptor_N Motif Other DBs NCBI-GeneID:  14495285 NCBI-ProteinID:  XP_004179824 UniProt:  I2H1Q3 LinkDB All DBs Position 3:complement(1234414..1234689) Genome browser AA seq 91 aa AA seqDB search MASTPPGGHKTLQKRKFAQQARDRATKQRPTSSRQAGFGGSSAAVLKIATDDSSTSSLRV DPLVILFMSVGFIFSVIVLHVLAKMAAKSVE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcttctacacctccaggtggtcataagaccttacaaaagagaaaatttgctcaacaa gcccgtgatcgtgctaccaaacaaagacctacttcttcaagacaagcagggttcggtggc tcttctgctgcagttttaaaaatcgctactgatgattcttcaacctcttctttaagagta gacccattggttattttattcatgtccgttggtttcatcttctcggtcatcgtattgcat gtattggcaaagatggctgctaaatccgttgagtaa

DBGET integrated database retrieval system