KEGG   Tetrapisispora blattae: TBLA_0E04060
Entry
TBLA_0E04060      CDS       T02489                                 
Symbol
TBLA0E04060
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04111  Cell cycle - yeast
tbl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TBLA_0E04060 (TBLA0E04060)
   04113 Meiosis - yeast
    TBLA_0E04060 (TBLA0E04060)
SSDB
Motif
Pfam: Fungal_TACC
Other DBs
NCBI-GeneID: 14496534
NCBI-ProteinID: XP_004180980
UniProt: I2H509
LinkDB
Position
5:1019290..1021704
AA seq 804 aa
MATSENHSNNKHKETSQEILGNLDLNKMFSDNNNEISRTHDKDISSEFDVNPSPVRTQNN
NISHHSSLVTENNINSNNDNRKRSLTSDNNTNNSDRKGRENDDIRDEQHGDGGDDDHLSK
KIKLTSDDIPNLQQPNSNADDDSKSNDVDGSPVAIEMYDNQISPIKINFDDVDSPYHIAT
VASNAKNNNSPLPKSQGTDSNSDNNNDNNNDNNNDNNNANNSLINRETSLSTPSKNTTFE
LQKLTPIRNANHNSINNEEQNSFMKLIEAEHREYQELIQRNEEITDRLHCLDKQYNQLLS
KHEQTNYQYQIIKNKNDTINKKFDNKILQLNKEIENYKIKVEKLNNKLQTNKKRLLETRD
EVKMLNQNQSILQEKFDKQSHEILELRNIDDSKEKYKFELENKLKVKDDENLSKTNEINL
LTDDLQKLQEQLDLKLKELSNNSLKLEELNDLIERKDLEIKEINEKYQGTINLNEGKHDD
LVKQVEELIMKRIELETQLDQQDKDTKEIIEQIKKELNKMEEDKNSKEYQIIEFEKKIDE
LQGKINNQNDELLKLKESYDKINDNFEIKNAEVIQLNEEIKELRSNEINLKEKISNDEKN
SNDWKAKYESSKIENEKILIEKSENHSMKINELNEDHLKELENIHETMKILQQDLKTNIE
TLNNVTNIKIDLEVENLELKKKLKALEVGTETETETETETKTKIETKENLVYEESQEEKD
KLKAKDDQIEQLKISFEEDQTKIKNLTQQLNESLEQIQKNKEESDNRIRLMADDLYNQYA
AKHAQKVLMLKKGYEKNIKKNSMI
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggctacttctgaaaaccattcaaataataaacataaggaaacctctcaagaaatttta
ggaaaccttgatttgaataaaatgttttctgataataataatgaaatatcaagaacacat
gataaagatataagttctgaatttgatgttaatccatcaccagtaagaactcaaaataat
aacatttctcatcattcttcattagttacggaaaataatattaacagtaacaatgataat
agaaaacgtagtttaacttctgataataataccaacaatagtgatagaaaggggagggag
aatgatgatattagagatgagcaacatggtgatggtggtgatgatgaccatttatccaag
aaaataaaattaacatctgatgatatccctaatttgcaacaaccaaactctaatgctgat
gacgattctaaatcaaatgatgttgatggatctccagtagccattgaaatgtatgataat
caaattagtcctattaaaattaattttgatgatgtagattctccatatcatattgcaact
gtagcatctaatgcaaaaaataacaactcacctttaccaaaatctcagggcacggatagt
aatagtgataataacaatgataataacaatgataataacaatgataataacaatgctaat
aacagtctcattaacagagaaacatctctatcaacgcctagtaagaatactacatttgaa
ttacaaaaattgactccaattcgcaatgctaatcataatagcataaataatgaggaacaa
aatagttttatgaaattaattgaagctgagcatagagaatatcaagaattaattcaaaga
aatgaagaaatcacggatagattacattgtttagataaacaatataatcaattactttcc
aaacatgaacaaactaattatcaatatcaaattatcaagaataaaaacgacactattaat
aaaaaatttgataataagatacttcaacttaataaagagattgaaaattataagattaaa
gtggagaaattaaataataaattacaaacaaacaagaaaagattactggaaacccgtgat
gaagttaaaatgttaaatcaaaatcaaagtatattacaagaaaagtttgataaacaaagt
catgaaattcttgaattgagaaacattgatgatagtaaagaaaaatataaatttgaatta
gaaaataaacttaaagtcaaagatgatgaaaatctttctaaaacaaatgaaattaatctt
ttaactgatgatttacaaaaattacaagaacaattggatttgaaattaaaagaactctct
aataactcattaaaattggaagaattaaatgatctaattgaacgaaaggatttggagatt
aaagagattaatgaaaaatatcaaggtaccataaatctaaatgaaggtaaacatgatgat
ttagttaaacaagtggaagaattaatcatgaaaagaattgaacttgaaacacaattggat
caacaagataaggatactaaagaaattattgaacaaataaagaaagaattaaataaaatg
gaggaagacaaaaattctaaagaatatcaaattattgaatttgaaaaaaaaattgatgaa
ttacaagggaaaattaataatcagaatgacgaacttttaaaattaaaagaatcttatgat
aagattaatgataattttgaaattaagaatgctgaagtaattcaattgaatgaagaaatt
aaagaattacgaagtaatgaaattaatttaaaagaaaaaatatctaacgatgagaaaaat
agcaatgattggaaagctaaatatgaatcatctaagattgaaaatgaaaaaatcttgatt
gaaaagagtgaaaatcattcaatgaaaataaatgaattgaatgaagatcatttaaaagaa
ttagaaaatattcatgaaacaatgaagatcttacaacaagatttaaagacaaatattgaa
accttgaacaatgttactaatataaagattgatttagaagtagagaatttagaattaaag
aagaagttaaaagcccttgaagttggaactgaaactgaaactgaaactgaaactgaaact
aaaactaaaattgaaaccaaagaaaatttagtttatgaagaatctcaagaagagaaggat
aagctaaaagccaaagacgatcaaattgaacaattaaagatttcattcgaagaagatcaa
actaagattaaaaatctcacacaacaattaaatgaatctctagaacaaatacagaaaaat
aaagaagagtctgacaataggatacgattaatggctgacgatttatataatcaatatgca
gctaaacatgcacaaaaggtattgatgctgaaaaaaggctatgaaaaaaatatcaagaaa
aattccatgatttaa

DBGET integrated database retrieval system