Henningerozyma blattae: TBLA_0F01420 Help Entry TBLA_0F01420      CDS       T02489                                  Symbol TBLA0F01420 Name (RefSeq) hypothetical protein   KO K12161   ubiquitin related modifier 1 Organism tbl  Henningerozyma blattae Pathway tbl04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:tbl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     TBLA_0F01420 (TBLA0F01420)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:tbl03016]     TBLA_0F01420 (TBLA0F01420)    04121 Ubiquitin system [BR:tbl04121]     TBLA_0F01420 (TBLA0F01420) Transfer RNA biogenesis [BR:tbl03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     TBLA_0F01420 (TBLA0F01420) Ubiquitin system [BR:tbl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    TBLA_0F01420 (TBLA0F01420) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 DHH_CID Motif Other DBs NCBI-GeneID:  14496794 NCBI-ProteinID:  XP_004181204 UniProt:  I2H5N3 LinkDB All DBs Position 6:347588..347899 Genome browser AA seq 103 aa AA seqDB search MALNITVEFLGGLDVTFNKQRVWQLSVPIPQDKGQVTMEDLINYIVNTMIADKNSVGDFV EDGTVRPGILTLINDTDWELEGEGAYVLEKGDVISFTSTLHGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctttgaatattacggttgaatttctagggggtctagacgtcacctttaataaacaa cgtgtctggcaattgtctgttcccattccacaagacaaaggccaagtcactatggaggac cttataaactacattgtgaataccatgattgcagacaagaatagtgtgggcgactttgtc gaagatggtactgtcagaccaggaatcctgactttgattaacgatactgattgggaactg gagggtgaaggcgcatacgtcctagagaagggcgacgtaatctctttcacctccaccctg catggtggttga

DBGET integrated database retrieval system