Henningerozyma blattae: TBLA_0G00340 Help Entry TBLA_0G00340      CDS       T02489                                  Symbol TBLA0G00340 Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism tbl  Henningerozyma blattae Pathway tbl00510   N-Glycan biosynthesis tbl00513   Various types of N-glycan biosynthesis tbl01100   Metabolic pathways tbl04141   Protein processing in endoplasmic reticulum Module tbl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:tbl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     TBLA_0G00340 (TBLA0G00340)    00513 Various types of N-glycan biosynthesis     TBLA_0G00340 (TBLA0G00340)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     TBLA_0G00340 (TBLA0G00340) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  14497115 NCBI-ProteinID:  XP_004181502 UniProt:  I2H6I1 LinkDB All DBs Position 7:64743..64859 Genome browser AA seq 38 aa AA seqDB search MISDNQLNSLVIFFGLTMMTLIVIYHVVDSTFNEKKNN NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgatctctgataaccaattgaactccttagttattttctttggtttgaccatgatgact ttaatcgttatttatcatgttgtggattctactttcaatgaaaagaaaaacaattaa

DBGET integrated database retrieval system