Thiolapillus brandeum: TBH_C0551 Help Entry TBH_C0551         CDS       T03600                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tbn  Thiolapillus brandeum Brite KEGG Orthology (KO) [BR:tbn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tbn03036]     TBH_C0551 Chromosome and associated proteins [BR:tbn03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     TBH_C0551 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  BAO43496 UniProt:  A0A7U6GH11 LinkDB All DBs Position 580653..580937 Genome browser AA seq 94 aa AA seqDB search MKASRRIMLALLTLAVLVSAIAVVHSKYRSRVLFRELKALDRQIDEVDIEWEQLLLEHGT WGTPAHIEASARKQLKMRMPRADEIVIIKEQHGG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaagcttcacgcaggatcatgctggcgttgttgacgctggcggtgctggtatctgcg atagccgtggtacacagcaaataccgctccagagtgctgttcagggagttgaaggcgctg gacaggcagatcgatgaagtggatatcgaatgggagcaactgctcctcgagcatggaacc tggggaacgccggcccacatcgaggccagcgcccgaaagcagttgaaaatgcgtatgcca agagcagacgagattgtgatcatcaaggagcaacatggcggctag

DBGET integrated database retrieval system