Thiolapillus brandeum: TBH_C0722 Help Entry TBH_C0722         CDS       T03600                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism tbn  Thiolapillus brandeum Brite KEGG Orthology (KO) [BR:tbn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tbn03032]     TBH_C0722    03036 Chromosome and associated proteins [BR:tbn03036]     TBH_C0722    03400 DNA repair and recombination proteins [BR:tbn03400]     TBH_C0722 DNA replication proteins [BR:tbn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     TBH_C0722 Chromosome and associated proteins [BR:tbn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     TBH_C0722 DNA repair and recombination proteins [BR:tbn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       TBH_C0722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  BAO43660 UniProt:  A0A7U6JHX7 LinkDB All DBs Position 775395..775667 Genome browser AA seq 90 aa AA seqDB search MNKKELAESMADAADISQAAAARALDGMIAAVTKALQEGDTVSIIGFGSFLVRDRAARTG RNPKTGEAIEIKASKSPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaaagaattggctgaatccatggcagacgccgcagacatctcgcaggccgcc gcagcccgtgccttggacggcatgatagcagccgttaccaaagcgctgcaggaaggcgac accgtgtccattatcggcttcggcagtttcctcgttcgagaccgtgccgcacgtactgga cgcaatcccaagaccggtgaagccattgaaatcaaggcttcaaaatccccggcatttaaa gctggtaaagcactaaaagatgcagtaaactag

DBGET integrated database retrieval system