Thermoanaerobacter brockii: Thebr_1315 Help Entry Thebr_1315        CDS       T01409                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tbo  Thermoanaerobacter brockii Pathway tbo01100   Metabolic pathways tbo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tbo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Thebr_1315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Thebr_1315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ribosomal_L12_N DUF1493 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ADV79889 UniProt:  E8UTH8 LinkDB All DBs Position complement(1318148..1318375) Genome browser AA seq 75 aa AA seqDB search MIFEKVRDIIAEQLGIDPEEITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEK IKTVGDVVEYLSNLE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatttttgaaaaagtaagggacataatagccgaacaactcggcattgatccagaggaa ataacgatggagtcatcttttatagatgatttaggagcagactctttggacatagtagag ctcataatggctctggaagaagagtttgatattgaaattcctgatgaagatgctgaaaag attaaaacagtaggtgatgtagtagaatacttaagcaatcttgaataa

DBGET integrated database retrieval system