Telmatherina bonti: 306767485 Help Entry 306767485         CDS       T12083                                  Symbol arf6a Name (RefSeq) ADP-ribosylation factor 6a   KO K07941   ADP-ribosylation factor 6 Organism tbt  Telmatherina bonti Pathway tbt04144   Endocytosis tbt04517   IgSF CAM signaling tbt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tbt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     306767485 (arf6a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     306767485 (arf6a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     306767485 (arf6a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tbt04131]     306767485 (arf6a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tbt04147]     306767485 (arf6a)    04031 GTP-binding proteins [BR:tbt04031]     306767485 (arf6a) Membrane trafficking [BR:tbt04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     306767485 (arf6a)   Arf GTPases and associated proteins    Arf GTPases     306767485 (arf6a) Exosome [BR:tbt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    306767485 (arf6a)   Exosomal proteins of colorectal cancer cells    306767485 (arf6a) GTP-binding proteins [BR:tbt04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     306767485 (arf6a) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  306767485 NCBI-ProteinID:  XP_079111643 LinkDB All DBs Position 16:26237451..26240264 Genome browser AA seq 175 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKT NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatgctttcgaagatctttggcaacaaggagatgaggatattgatgcttgga cttgatgcagctggaaaaacaaccatcttgtacaagctgaaactgggacagtctgtcacc accatccccacggttgggttcaacgtggagaccgtcacctataagaatgtgaagttcaat gtgtgggacgtgggcggccaggataagatcaggcccctttggagacattactacacaggc acccaaggcctcatttttgtggtagactgtgccgacagggacaggatcgacgaggcaagg caggagctccatcgaatcataaacgaccgtgaaatgagggacgccatcatcctgatcttc gccaacaaacaggatctcccagatgccatgaagccccacgagatacaggagaagctgggc ttgacccgaattagagatagaaattggtacgttcagccgtcctgtgcaacaacaggggat ggactatacgagggccttacctggcttacctcaaattacaaaacttaa

DBGET integrated database retrieval system