Thermomonas brevis: H9L17_10675 Help Entry H9L17_10675       CDS       T06816                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tbv  Thermomonas brevis Brite KEGG Orthology (KO) [BR:tbv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tbv03036]     H9L17_10675 (ftsL) Chromosome and associated proteins [BR:tbv03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H9L17_10675 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QNN45667 UniProt:  A0A7G9QQP2 LinkDB All DBs Position 2317715..2317981 Genome browser AA seq 88 aa AA seqDB search MNRYFLLAVLVLANVATALLIVRDRHDHRQAFVELSKLEKARDALNIEFGRLQLEQATWA ESNRVDQVARTRLGMEFPRTEDVVVLRR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaccgctatttcctgctcgccgtgctggtgctcgccaacgtcgcgaccgcgctgctg atcgtgcgcgaccgccacgaccaccgccaggccttcgtcgagctgagcaagctggagaag gcgcgcgacgcgctcaacatcgaattcggccgcctgcagctggagcaggccacttgggcg gaaagcaaccgcgtcgaccaggtggcgcgcacccgcctgggcatggagttcccgcgcacc gaagacgtcgtggtgctgcgccgatga

DBGET integrated database retrieval system