KEGG   Trueperella bialowiezensis: NCTC13354_01428
Entry
NCTC13354_01428   CDS       T05959                                 
Symbol
nuoJ
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
tbw  Trueperella bialowiezensis
Pathway
tbw00190  Oxidative phosphorylation
tbw01100  Metabolic pathways
Module
tbw_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tbw00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC13354_01428 (nuoJ)
Enzymes [BR:tbw01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     NCTC13354_01428 (nuoJ)
SSDB
Motif
Pfam: Oxidored_q3 YtpI
Other DBs
NCBI-ProteinID: VEI13707
UniProt: A0A3S4WH03
LinkDB
Position
1:1549061..1549996
AA seq 311 aa
MLEISLGEMIIFGVVAVMMVALALYGLLFARKAVHSVVCVIFIMVGLAVLYTAQEAPFLG
VAQVVVYTGAILMMFLFVLMLIGVDSADSTHETLKGQRAVAVLGGLGVAAILIGVLLGAA
HPPAVGLEAANTEGNPVGVAKSIFSNHVLTLQITGTLLIVAALGAMTLTHKDRLRPIVTQ
EERAHRKMRDFITKGTHVGHKPNPGVYAESNSSANPALTAYGQPEKGSVNRVLQIRGQVR
TVGEISPKTVERIATGDGISGPSTYGKVGRSKLMGMPGEIAPDHDAALKRLEQLESGSGH
TAELEAQEDDQ
NT seq 936 nt   +upstreamnt  +downstreamnt
atgctagagatttctcttggcgagatgatcatcttcggcgtcgttgccgtcatgatggtc
gcactcgcactgtacgggctactgtttgcacgcaaggccgtgcactccgtggtctgcgtc
attttcatcatggtgggactcgcagtgttgtacaccgcgcaggaggccccattcctcggg
gtggctcaagtggtggtctataccggggcgattctcatgatgttcctcttcgtgctcatg
cttattggcgtggattctgctgactcgacccacgaaacgctcaaggggcagcgtgccgtg
gccgtgctcggcgggctcggcgtggcggcgatccttatcggcgtgctgctgggagccgcg
catccgccggccgtgggcctcgaggcggcgaacacggagggcaacccggtgggcgtggcc
aagtcgatcttctccaaccacgtgctcaccttgcagatcaccggcacgctgctcatcgtg
gcggcgctcggcgcgatgacgctcacccacaaggatcgcttacgcccgatcgtcacccaa
gaagagcgtgcacaccgcaagatgcgcgacttcatcaccaagggcacccatgtgggccac
aagccgaacccgggcgtgtacgcggagtccaactcctcggccaatcccgcgctgacggcc
tacggccagcctgagaagggctcggtgaaccgcgtgctgcagatccgcgggcaggtgcgt
acggttggcgaaatttcgccgaagaccgtggaacgcatcgcaaccggggatggtatttcc
gggccgagcacctacggcaaggtcggcaggtcgaagctcatgggcatgcccggcgagatc
gcacccgatcacgacgcggcgctcaagcgtttggaacagcttgaatccggtagcgggcac
accgccgaactcgaagcgcaggaggatgaccaataa

DBGET integrated database retrieval system