Tribolium castaneum (red flour beetle): 100240683 Help Entry 100240683         CDS       T01046                                  Symbol Rpb10, POLR2L Name (RefSeq) RNA polymerase II subunit 10   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism tca  Tribolium castaneum (red flour beetle) Pathway tca03020   RNA polymerase tca03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tca00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     100240683 (Rpb10)   09124 Replication and repair    03420 Nucleotide excision repair     100240683 (Rpb10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tca03021]     100240683 (Rpb10)    03400 DNA repair and recombination proteins [BR:tca03400]     100240683 (Rpb10) Transcription machinery [BR:tca03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      100240683 (Rpb10)   RNA polymerase III system    RNA polymerase III      100240683 (Rpb10)   RNA polymerase I system    RNA polymerase I      100240683 (Rpb10) DNA repair and recombination proteins [BR:tca03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       100240683 (Rpb10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  100240683 NCBI-ProteinID:  NP_001137388 LinkDB All DBs Position LG3:17098092..17098625 Genome browser AA seq 67 aa AA seqDB search MIIPVRCFTCGKVIGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLL NYAPLEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgattataccggttcgttgttttacttgtgggaaagttattggaaataaatgggaggct tatcttgggcttttgcaagctgaatatacggaaggagatgcgttggatgctttgggtttg aagaggtactgttgcagaagaatgcttcttggacacgtcgatcttattgaaaagttattg aattatgctcctttagagaagtaa

DBGET integrated database retrieval system