Tribolium castaneum (red flour beetle): 107399065 Help Entry 107399065         CDS       T01046                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism tca  Tribolium castaneum (red flour beetle) Pathway tca03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:tca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107399065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tca03036]     107399065   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tca04147]     107399065 Chromosome and associated proteins [BR:tca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107399065 Exosome [BR:tca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107399065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  107399065 NCBI-ProteinID:  XP_015840236 LinkDB All DBs Position Un Genome browser AA seq 83 aa AA seqDB search MSGRGKGGKVKGKAKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKLVLFHVIF NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaaaggaggaaaggtaaaaggaaaagccaagtctcgttcgagcagg gccggtcttcagtttcctgttggaagaatacatcgtttacttcgtaaaggtaattacgcc gaacgagtcggtgccggtgctccagtttatttggcggctgtgatggaatatcttgccgct gaagttcttgaattggctggaaatgctgctcgtgacaacaaaaaactcgtattattccac gtcatcttc

DBGET integrated database retrieval system