Tribolium castaneum (red flour beetle): 656798 Help Entry 656798            CDS       T01046                                  Symbol Rac1 Name (RefSeq) Ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tca  Tribolium castaneum (red flour beetle) Pathway tca04013   MAPK signaling pathway - fly tca04145   Phagosome tca04148   Efferocytosis tca04310   Wnt signaling pathway tca04620   Toll-like receptor signaling pathway tca05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tca00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     656798 (Rac1)    04310 Wnt signaling pathway     656798 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     656798 (Rac1)    04148 Efferocytosis     656798 (Rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     656798 (Rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     656798 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tca04131]     656798 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tca04147]     656798 (Rac1)    04031 GTP-binding proteins [BR:tca04031]     656798 (Rac1) Membrane trafficking [BR:tca04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     656798 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     656798 (Rac1)   Macropinocytosis    Ras GTPases     656798 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     656798 (Rac1) Exosome [BR:tca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    656798 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    656798 (Rac1)   Exosomal proteins of colorectal cancer cells    656798 (Rac1)   Exosomal proteins of bladder cancer cells    656798 (Rac1) GTP-binding proteins [BR:tca04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     656798 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  656798 NCBI-ProteinID:  XP_968397 UniProt:  D6WGS1 LinkDB All DBs Position LG3:20029383..20038199 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDRGTIEKLKDKKLTPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV MQVKPKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgataaagtgcgtggttgtgggtgatggtgctgttggtaaaacatgcctcctc atcagttacacaacaaacgccttcccaggcgaatatataccgactgtttttgacaactat tcggcaaatgttatggtagatgggaagccgattaatttggggctttgggatacagcaggc caggaagattatgacagattaagaccactttcctacccacaaacagatgtgttcttaatt tgcttttcgttggtaaatccagcatcgtttgagaacgttcgggcgaaatggtaccctgaa gtcagacaccattgtccaaacacaccaattatcctagttggcacaaaattggatttgcgt gacgatagaggcactattgagaaactgaaagacaagaaacttacacccatcacatatccg cagggtttggcgatggcgaaagaaatcagcgctgtaaaatacctagaatgttcagcgttg acgcaaaaaggacttaaaacagttttcgatgaagccattcgagcagttctttgccccgta atgcaagtcaaacctaaacgtaaatgtgtgttattgtaa

DBGET integrated database retrieval system