Tribolium castaneum (red flour beetle): 660032 Help Entry 660032            CDS       T01046                                  Name (RefSeq) glutathione S-transferase 1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism tca  Tribolium castaneum (red flour beetle) Pathway tca00480   Glutathione metabolism tca00980   Metabolism of xenobiotics by cytochrome P450 tca00982   Drug metabolism - cytochrome P450 tca00983   Drug metabolism - other enzymes tca01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:tca00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     660032   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     660032    00982 Drug metabolism - cytochrome P450     660032    00983 Drug metabolism - other enzymes     660032  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tca02000]     660032 Enzymes [BR:tca01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      660032 Transporters [BR:tca02000]  Other transporters   Pores ion channels [TC:1]    660032 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_2 GST_N_3 GST_C_3 GST_N_2 GST_N GST_N_4 GST_C_7 Motif Other DBs NCBI-GeneID:  660032 NCBI-ProteinID:  XP_971389 UniProt:  D6WFC7 LinkDB All DBs Position LG3:1721112..1722165 Genome browser AA seq 198 aa AA seqDB search MRPKLYMSEICPSARAVVLTAKVLELTLELKEVSCDKKLNQQFSIPTLEDSGYVIWDSHA IIAFLVGKYGKDDSLYPRDNPRRAIIDERLRFDSGVVSFFTKTILNSIPYEDNEKAVNEI YSLVEEFFDGNNPWIAGDALSIADLSLIPSITSLDVVVPIDPKRFPKLARWVKRAETMPF FEANKTGLCKLRRILNRC NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgcgccccaagttgtacatgagcgagatatgtccctcagctagagccgtcgtgttgaca gccaaggtcctcgaactcaccctcgagctgaaggaggtttcttgcgacaaaaagttgaat caacaattctccatccctacgctggaggacagcggctacgtgatttgggacagccatgcc attattgccttcctggtcgggaagtacggcaaagacgactccttgtaccccagagacaac ccccggagggccattatagacgaacgattgcggtttgactcgggggtcgtgtcttttttc accaaaacgattctgaactcgataccatacgaagataatgaaaaagccgtcaatgaaatt tattccttggttgaggaattcttcgatggtaacaacccatggatcgctggggatgcttta agcatcgcagacttaagtctaattccttcgatcacgtcgctggatgttgtggtccctatt gaccccaagcggttccctaagttagcaagatgggtgaaaagagccgaaacaatgcccttt tttgaggcaaataagaccgggctctgtaaactccgaaggattctaaaccggtgttaa

DBGET integrated database retrieval system