Tribolium castaneum (red flour beetle): 660912 Help Entry 660912            CDS       T01046                                  Symbol RhoL Name (RefSeq) Rho-like protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tca  Tribolium castaneum (red flour beetle) Pathway tca04013   MAPK signaling pathway - fly tca04145   Phagosome tca04148   Efferocytosis tca04310   Wnt signaling pathway tca04620   Toll-like receptor signaling pathway tca05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tca00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     660912 (RhoL)    04310 Wnt signaling pathway     660912 (RhoL)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     660912 (RhoL)    04148 Efferocytosis     660912 (RhoL)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     660912 (RhoL)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     660912 (RhoL)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tca04131]     660912 (RhoL)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tca04147]     660912 (RhoL)    04031 GTP-binding proteins [BR:tca04031]     660912 (RhoL) Membrane trafficking [BR:tca04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     660912 (RhoL)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     660912 (RhoL)   Macropinocytosis    Ras GTPases     660912 (RhoL)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     660912 (RhoL) Exosome [BR:tca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    660912 (RhoL)   Exosomal proteins of other body fluids (saliva and urine)    660912 (RhoL)   Exosomal proteins of colorectal cancer cells    660912 (RhoL)   Exosomal proteins of bladder cancer cells    660912 (RhoL) GTP-binding proteins [BR:tca04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     660912 (RhoL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Motif Other DBs NCBI-GeneID:  660912 NCBI-ProteinID:  XP_008200455 UniProt:  D6WKP8 LinkDB All DBs Position LG5:7462137..7463923 Genome browser AA seq 195 aa AA seqDB search MTTPSREENGPPGENVKVTVVGDGVVGKTCLLISYTKDEFPEEYVPTVFEHYGQDITVDD VKYNMTLWDTAGQEDYERLRPLAYPNTKCFLVCFSVDASIPSYENVIIKWVPEVRHHNPH TPIVLVATKIDLRDDPSVHCYSTQDGKKLKRKVKAEGYVECSAKTREGLKEVFEEAIRAY KKTKIKARQVNCALL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgacgacgccttcgagagaagaaaacggccctccgggcgaaaacgttaaagtcacagtg gtcggagacggtgtagtgggaaaaacctgtctcttgatttcatacacgaaggacgagttc cccgaagaatatgttcccacagtattcgaacattacgggcaagacatcaccgtcgacgac gtcaaatacaacatgactctctgggacactgccggccaagaagactacgaaagactgcgc cccctggcttaccccaatacgaaatgcttccttgtatgtttctccgtcgacgcttctata ccgtcttacgagaacgttataattaaatgggtgccagaagtcaggcaccacaatccacac acgcccatagttctagtagccactaaaatagatctcagagatgatccaagtgtccactgt tactcaacccaggacggcaaaaaattaaaaaggaaagtcaaagccgaaggatacgtcgaa tgctctgccaaaaccagggaaggactgaaggaagtcttcgaagaggcgatacgagcgtac aagaagaccaaaatcaaagcgagacaagtcaactgtgctttgttataa

DBGET integrated database retrieval system