Tribolium castaneum (red flour beetle): 662142 Help Entry 662142            CDS       T01046                                  Name (RefSeq) UPF0691 protein C9orf116   KO K28113   piercer of microtubule wall 1 protein Organism tca  Tribolium castaneum (red flour beetle) Brite KEGG Orthology (KO) [BR:tca00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tca03037]     662142 Cilium and associated proteins [BR:tca03037]  Motile cilia and associated proteins   Other motile cilia associated proteins    662142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PIRC1_2 Motif Other DBs NCBI-GeneID:  662142 NCBI-ProteinID:  XP_008201108 UniProt:  D6W9L0 LinkDB All DBs Position LG2:9767319..9769942 Genome browser AA seq 102 aa AA seqDB search MDCGNSGGGHMTVLKTSDFYRTCELPKRFEYPSWFYGYGIQRRPPEHPFYRTTSSDYGRY PPTIHTVPTSFFPNNQQFSKALAKTGMYRNYSLNTGLDHTPY NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggattgcgggaattcgggaggcggccacatgaccgtcctcaaaacctcggacttttac cgtacttgcgaactaccgaaaagatttgaatatccgtcttggttttatggatatgggatt cagcggagaccgccggaacatccgttttataggaccacttcgagcgattacgggagatac ccgccgaccatacacacagtacccacgtctttttttcccaataatcaacaattcagtaaa gcgcttgccaagacgggcatgtacaggaattactcgctcaatacgggcctggaccacacg ccatattaa

DBGET integrated database retrieval system