Thermofilum adornatum 1505: TCARB_1676 Help Entry TCARB_1676        CDS       T03526                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism tcb  Thermofilum adornatum 1505 Pathway tcb03060   Protein export tcb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tcb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TCARB_1676    04141 Protein processing in endoplasmic reticulum     TCARB_1676  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     TCARB_1676  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tcb04131]     TCARB_1676   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tcb02044]     TCARB_1676 Membrane trafficking [BR:tcb04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     TCARB_1676 Secretion system [BR:tcb02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    TCARB_1676 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE DUF2207_C DUF4212 Phage_holin_2_3 Gram_pos_anchor Motif Other DBs NCBI-ProteinID:  AJB42716 UniProt:  A0A3G1A6U5 LinkDB All DBs Position complement(1493941..1494219) Genome browser AA seq 92 aa AA seqDB search MSSKSGKLSDTIIRLLRMVSRPEPEEYKMMLRVVLIGLGLLGTIGFVFQLMGSFLEFAGL GGISREYVLLGGIIIIVVILVLAVYLRRREEI NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagtagcaaaagtggcaaactcagcgacacaattatccggctattgaggatggtttca cgcccagaaccagaagaatacaagatgatgctacgagtagtgctaattggtctgggtctc ctaggaaccataggcttcgtattccagctgatgggctcgttcctagaatttgctggcctg ggaggcatctctagggaatacgtactcctaggaggaataatcatcatagtggtaatcctc gtcctcgccgtctatctacgcagacgcgaagaaatatag

DBGET integrated database retrieval system