Thermofilum adornatum 1505: TCARB_1718 Help Entry TCARB_1718        CDS       T03526                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tcb  Thermofilum adornatum 1505 Pathway tcb03010   Ribosome Brite KEGG Orthology (KO) [BR:tcb00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TCARB_1718   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TCARB_1718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tcb03011]     TCARB_1718    04121 Ubiquitin system [BR:tcb04121]     TCARB_1718   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tcb04147]     TCARB_1718 Ribosome [BR:tcb03011]  Ribosomal proteins   Eukaryotes    Small subunit     TCARB_1718   Archaea     TCARB_1718 Ubiquitin system [BR:tcb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TCARB_1718 Exosome [BR:tcb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TCARB_1718   Exosomal proteins of colorectal cancer cells    TCARB_1718 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT DUF7479 TackOD1 Zn_ribbon_RPB9 Zn_ribbon_3 EDR4-like_1st Zn_ribbon_Nudix Zn_ribbon_PriA Zn_ribbon_RanBP Ribosomal_L37ae DUF1451 Med16_C Zn_ribbon_Com zf_UBZ zf-C2H2_ZN142 zf-C2H2_FBX41 DUF6758 Zn_ribbon_ISL3 zf-tcix Motif Other DBs NCBI-ProteinID:  AJB42758 UniProt:  A0A3G1A8S7 LinkDB All DBs Position complement(1525418..1525576) Genome browser AA seq 52 aa AA seqDB search MSKVHELYEYDYKAGTIKLKNKKCPRCGSVMAHHMKPVERWHCGKCGYTEFV NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggttcacgagttatacgagtacgactataaggccggcacaatcaagctaaaa aacaagaagtgcccaaggtgcggctccgtaatggctcaccacatgaagccagtcgagaga tggcattgtggtaagtgtggctacaccgagtttgtatag

DBGET integrated database retrieval system