Theobroma cacao (cacao): 18589014 Help Entry 18589014          CDS       T02994                                  Name (RefSeq) uncharacterized LOC18589014   KO K03873   elongin-B Organism tcc  Theobroma cacao (cacao) Pathway tcc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     18589014  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tcc04121]     18589014    03400 DNA repair and recombination proteins [BR:tcc03400]     18589014 Ubiquitin system [BR:tcc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      18589014    Cul5 complex      18589014 DNA repair and recombination proteins [BR:tcc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      18589014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 DUF3969 Rad60-SLD_2 Ubiquitin_5 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  18589014 NCBI-ProteinID:  XP_017983340 UniProt:  A0AB32WY73 A0A061GWI4 LinkDB All DBs Position 9:complement(9044838..9048477) Genome browser AA seq 103 aa AA seqDB search MAMYIRVKRSKTTYFIQCDPTETALDIKQKLHTLIDQPVNDQRLILVNTGEILEDSKTLA DQKVENDAVVALTLRKDDNEFEDVNIVQPNDFYQSRDADSGNW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctatgtacattcgtgtcaagcgtagcaagacgacatactttatccagtgtgatcct actgagactgctttagacataaagcaaaagttgcataccctcattgatcaacctgttaat gatcagcgtttgatcctagtgaatacaggggaaatattagaggattcaaaaactttagca gatcagaaggttgaaaatgatgctgttgtggcactgaccttgagaaaagatgacaatgag tttgaggatgtcaacatagtacaaccaaacgatttctaccaatctcgtgatgcagatagt ggaaattggtga

DBGET integrated database retrieval system