Theobroma cacao (cacao): 18591583 Help Entry 18591583          CDS       T02994                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tcc  Theobroma cacao (cacao) Pathway tcc04145   Phagosome tcc04148   Efferocytosis tcc04620   Toll-like receptor signaling pathway tcc05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tcc00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18591583    04148 Efferocytosis     18591583  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18591583  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18591583  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tcc04131]     18591583   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tcc04147]     18591583    04031 GTP-binding proteins [BR:tcc04031]     18591583 Membrane trafficking [BR:tcc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18591583  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18591583   Macropinocytosis    Ras GTPases     18591583  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18591583 Exosome [BR:tcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18591583   Exosomal proteins of other body fluids (saliva and urine)    18591583   Exosomal proteins of colorectal cancer cells    18591583   Exosomal proteins of bladder cancer cells    18591583 GTP-binding proteins [BR:tcc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18591583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Motif Other DBs NCBI-GeneID:  18591583 NCBI-ProteinID:  XP_007017852 UniProt:  A0A061FEC9 A0AB32UUS0 LinkDB All DBs Position 8:2126246..2128628 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKL DLRDDQQFFVDHPGAVPISAAQGEELRKQIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKKNKKKKKAHGGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcgagattcataaagtgcgttaccgtcggcgatggcgccgtcggaaagacc tgcatgctgatttcctacaccagcaatactttccctacggactatgtcccaactgttttc gacaatttcagtgcaaatgttgttgtggatggcagcactgtcaacttaggcttatgggat actgctggtcaggaggattacaatagattaagaccgctgagctatcgtggggctgatgtc tttatacttgcattttctctcatcagcaaggccagttatgaaaatgtggccaagaagtgg attccggaattaaagcattatgcacctggtgttccgataattcttgttggaactaagctt gatctccgggatgatcagcaattttttgtagaccaccctggtgcagtgcctatttctgca gctcagggagaggaactaaggaaacagattgggtctcctgcctacattgagtgtagttca aaaacacagcagaatgtgaaggcagtttttgatgcagctattaaggtagtgctccagcct ccgaagaaaaataagaagaagaaaaaggcacatggtggttgctcaatactatga

DBGET integrated database retrieval system