Theobroma cacao (cacao): 18612074
Help
Entry
18612074 CDS
T02994
Name
(RefSeq) aspartate aminotransferase, mitochondrial
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
tcc
Theobroma cacao (cacao)
Pathway
tcc00220
Arginine biosynthesis
tcc00250
Alanine, aspartate and glutamate metabolism
tcc00270
Cysteine and methionine metabolism
tcc00330
Arginine and proline metabolism
tcc00350
Tyrosine metabolism
tcc00360
Phenylalanine metabolism
tcc00400
Phenylalanine, tyrosine and tryptophan biosynthesis
tcc00710
Carbon fixation by Calvin cycle
tcc00950
Isoquinoline alkaloid biosynthesis
tcc00960
Tropane, piperidine and pyridine alkaloid biosynthesis
tcc01100
Metabolic pathways
tcc01110
Biosynthesis of secondary metabolites
tcc01200
Carbon metabolism
tcc01210
2-Oxocarboxylic acid metabolism
tcc01230
Biosynthesis of amino acids
Module
tcc_M00170
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
tcc_M00171
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:
tcc00001
]
09100 Metabolism
09102 Energy metabolism
00710 Carbon fixation by Calvin cycle
18612074
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
18612074
00270 Cysteine and methionine metabolism
18612074
00220 Arginine biosynthesis
18612074
00330 Arginine and proline metabolism
18612074
00350 Tyrosine metabolism
18612074
00360 Phenylalanine metabolism
18612074
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
18612074
09110 Biosynthesis of other secondary metabolites
00950 Isoquinoline alkaloid biosynthesis
18612074
00960 Tropane, piperidine and pyridine alkaloid biosynthesis
18612074
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
tcc01007
]
18612074
Enzymes [BR:
tcc01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
18612074
Amino acid related enzymes [BR:
tcc01007
]
Aminotransferase (transaminase)
Class I
18612074
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Motif
Other DBs
NCBI-GeneID:
18612074
NCBI-ProteinID:
XP_007048727
UniProt:
A0A061DJL5
A0AB32VMV6
LinkDB
All DBs
Position
1:complement(9074704..9080394)
Genome browser
AA seq
424 aa
AA seq
DB search
MAIRRAMSGGLMGRTAVLGERSMSSWWRSVEPAPKDPILGVTEAFLADPNPDKVNVGVGA
YRDDNGKPVVLECVREAERRIAGYLNMEYLPMGGSVKMVEETLKLAYGENSELIKDRRIA
AVQALSGTGACRLFADFQKRFRPDSQIYIPVPTWANHHNIWRDAQVPQKTYHYYHPESRG
LDFATMMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWREISHQFKVKGHFAFFDMAYQG
FASGDPEKDAKSIRIFLEDGHYIGIAQSYAKNMGLYGQRVGCLSVLCKDEKQAVAVKSQL
QQLARPTYSNPPLHGALIVSTILGDPDLKKLWLKEVKVMADRIIGMRTALRGNLEKLGSP
LSWQHITNQIGMFCYSGLTPEQVDRLTNEFHIYMTRNGRISMAGVTTGNVEYLANAIHEV
TKSA
NT seq
1275 nt
NT seq
+upstream
nt +downstream
nt
atggctatccgaagagcgatgtcaggggggctcatggggcggacggcggtccttggagag
agatccatgtcgtcttggtggcgtagcgtggagcctgctccgaaggatccgattcttggt
gttacggaggcttttttggccgatcccaatcccgataaagtcaatgttggagtcggtgct
taccgtgatgataatggaaagccggtcgttttggaatgtgttagggaagccgagcgaagg
attgctggatatttgaacatggaatatcttcctatgggaggaagtgtgaagatggtggaa
gaaacactaaagttggcctatggagagaattctgagttgataaaagacagaaggatagca
gcagtccaagctctgtctgggactggcgcatgccgacttttcgcggacttccaaaagcgt
tttcgtcctgattcccaaatctatataccagtcccaacttgggccaaccaccacaacatc
tggagagatgctcaggtcccgcagaaaacttaccattattatcaccctgaatctaggggt
ttagattttgcaacaatgatggatgacatcaagaatgctccaaatggctcattctttcta
cttcatgcttgtgctcataaccctactggtgtggatcctacagaggagcagtggagagaa
atctcacaccagttcaaagtgaaaggtcattttgccttctttgacatggcatatcaaggt
tttgctagtggtgatccagagaaagatgcaaagtccatcaggatttttcttgaggatggt
cactatattggaattgcccaatcgtatgcaaagaatatgggactctatggccagcgggta
ggatgcctcagtgtgctttgcaaagatgaaaaacaagcagtagctgtgaaaagtcaattg
cagcagcttgcaagacccacgtacagcaacccacctcttcatggtgcactcatagtttca
accattcttggtgatccagacttgaagaaactatggctcaaagaagttaaggtcatggca
gatcgcataatcggaatgcgaacagctttacgagggaaccttgaaaagctagggtcacca
ttatcatggcagcacatcactaatcagatagggatgttttgctatagcgggttgacaccg
gaacaggtggatcgcttgacaaatgaatttcacatctatatgactcgcaatggtagaatc
agtatggctggcgttacaacgggcaatgttgaatatttggctaatgcgattcatgaagtc
acaaaatccgcatag
DBGET
integrated database retrieval system