Theobroma cacao (cacao): 18613263 Help Entry 18613263          CDS       T02994                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism tcc  Theobroma cacao (cacao) Pathway tcc04016   MAPK signaling pathway - plant tcc04070   Phosphatidylinositol signaling system tcc04075   Plant hormone signal transduction tcc04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:tcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     18613263    04070 Phosphatidylinositol signaling system     18613263    04075 Plant hormone signal transduction     18613263  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     18613263  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tcc01009]     18613263   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tcc04131]     18613263    03036 Chromosome and associated proteins [BR:tcc03036]     18613263   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tcc04147]     18613263 Protein phosphatases and associated proteins [BR:tcc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      18613263 Membrane trafficking [BR:tcc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     18613263 Chromosome and associated proteins [BR:tcc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      18613263 Exosome [BR:tcc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    18613263 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg Dockerin_1 SPEF2_C TerB Flagellar_rod EF_EFCAB10_C EH Caleosin DUF5580_M Secretin_N PA_Ig-like DUF1103 Phage_TAC_12 DUF7117 Oxidored_nitro MotA_activ DUF5580 Motif Other DBs NCBI-GeneID:  18613263 NCBI-ProteinID:  XP_017970717 UniProt:  A0AB32VTV7 LinkDB All DBs Position 1:29022608..29024565 Genome browser AA seq 148 aa AA seqDB search MPDTLTEDQIAEFREAFCLIDKDSDGFVTMEELATVIQTLDGNPTKEEVQDMISEVDVEG NRTIDFEDFLNIMATKMKENVADELKEAFKVFDRDQDGFISANELRQVMMNLGERLTVEE AEQMIKEADLDGDGLVSYEEFARMIMAF NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgccagatacattaacggaagatcaaattgccgagtttcgtgaagccttttgcctgatt gacaaagattcagatggcttcgttaccatggaagaattggcaacagtgatccaaacgtta gatggaaaccctacaaaagaagaagttcaagacatgattagtgaggttgatgttgaagga aataggaccattgattttgaagatttcttaaatattatggcaacaaaaatgaaggaaaac gtggccgatgaactgaaagaagctttcaaagtattcgacagggatcaagatggatttata tcagcaaatgagttgagacaagtaatgatgaatttgggagaaagactgacagtggaagaa gcagaacaaatgatcaaagaagcagacttggatggcgatggacttgtcagctatgaggag tttgccaggatgataatggccttctga

DBGET integrated database retrieval system