Thermohahella caldifontis: AAIA72_05430 Help Entry AAIA72_05430      CDS       T11202                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tcd  Thermohahella caldifontis Pathway tcd01100   Metabolic pathways tcd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AAIA72_05430 (acpP)    00074 Mycolic acid biosynthesis     AAIA72_05430 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AAIA72_05430 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 DUF7127 Ribosomal_L12_N DUF5783 Ribosomal_L50 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  XDT73412 UniProt:  A0AB39UZT5 LinkDB All DBs Position complement(1122050..1122283) Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQASSRFVEDLGADSLDTVELVMALEEEFEIEIPDEEA EKIATVQDAIDFIVSHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactgtagaagagcgcgtaaagaagattgtatgtgaacagcttggcgtcaaggag tccgaggtacaggcaagctcccggtttgtggaggatctgggcgcagactcgctggacacg gtcgagctggtgatggcgcttgaggaagaattcgagattgaaattcctgatgaggaagcg gagaagattgcgacggttcaggacgcaattgacttcatcgtttcacatcagtaa

DBGET integrated database retrieval system