Thermococcus celer: A3L02_00565 Help Entry A3L02_00565       CDS       T05076                                  Name (GenBank) cobalt transporter   KO K02009   cobalt/nickel transport protein Organism tce  Thermococcus celer Pathway tce02010   ABC transporters Brite KEGG Orthology (KO) [BR:tce00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     A3L02_00565  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tce02000]     A3L02_00565 Transporters [BR:tce02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     A3L02_00565    Nickel transporter     A3L02_00565 SSDB OrthologParalogGFIT Motif Pfam:  PDGLE Motif Other DBs NCBI-ProteinID:  ASI98167 UniProt:  A0A218NZQ7 LinkDB All DBs Position complement(113621..113869) Genome browser AA seq 82 aa AA seqDB search MRVVFKGLALIALLLAIVLPLASSNPDGLEATMEKVGLEENPLYHAPLNYGSTWGQGVLM GLLGITLAFGVSYGLARLFRGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagggtggtcttcaaagggctcgccctcatagcccttttgctcgcgatcgtccttccg ctcgcgtcgagcaatccagacggccttgaggccacgatggagaaggtcggcctcgaggag aatcccctctaccacgcccccttgaactacgggtcaacatgggggcagggcgtgctcatg gggttgcttggaataaccctggcattcggggtttcctacggtctggcaaggctcttcagg ggggcgtga

DBGET integrated database retrieval system