Thermococcus celer: A3L02_00660 Help Entry A3L02_00660       CDS       T05076                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tce  Thermococcus celer Pathway tce03010   Ribosome Brite KEGG Orthology (KO) [BR:tce00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L02_00660   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L02_00660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tce03011]     A3L02_00660    04121 Ubiquitin system [BR:tce04121]     A3L02_00660 Ribosome [BR:tce03011]  Ribosomal proteins   Eukaryotes    Large subunit     A3L02_00660   Archaea     A3L02_00660 Ubiquitin system [BR:tce04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L02_00660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 DZR Ribosomal_L40e Zn_ribbon_3 Zn_ribbon_RPAB4 Toxin_5 DZR_2 zf-nanos Zn_ribbon_10 HVO_0416 DUF7577 Motif Other DBs NCBI-ProteinID:  ASI98183 UniProt:  A0A218NZU4 LinkDB All DBs Position complement(123828..123986) Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYVCMRCGATNPWGAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattcccagaggctgaggcaaggatatttagaaagtacgtctgcatgcgctgt ggcgctaccaatccctggggagcaaagaagtgcaggaagtgcggttacaaaggtcttcgc ccgaaggccagggaaccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system