Thermococcus chitonophagus: CHITON_0466 Help Entry CHITON_0466       CDS       T04536                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tch  Thermococcus chitonophagus Pathway tch03010   Ribosome Brite KEGG Orthology (KO) [BR:tch00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CHITON_0466   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CHITON_0466  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tch03011]     CHITON_0466    04121 Ubiquitin system [BR:tch04121]     CHITON_0466   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tch04147]     CHITON_0466 Ribosome [BR:tch03011]  Ribosomal proteins   Eukaryotes    Small subunit     CHITON_0466   Archaea     CHITON_0466 Ubiquitin system [BR:tch04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CHITON_0466 Exosome [BR:tch04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CHITON_0466   Exosomal proteins of colorectal cancer cells    CHITON_0466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_NUD Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_Ribbon_1 MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  CUX77245 UniProt:  A0A160VQV3 LinkDB All DBs Position I:complement(423931..424083) Genome browser AA seq 50 aa AA seqDB search MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgggacagaagtggaagctctacatagttaaggacgggaaagtcataaggaagaacaag ttctgtcctaggtgtgggcccggagtgttcatggcagatcacggcgataggtgggcctgc ggaaagtgcggttacactgagtggaagaagtga

DBGET integrated database retrieval system