Thermococcus chitonophagus: CHITON_2070 Help Entry CHITON_2070       CDS       T04536                                  Name (GenBank) Archaeal histone   KO K24450   DNA-binding protein Organism tch  Thermococcus chitonophagus Brite KEGG Orthology (KO) [BR:tch00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tch03036]     CHITON_2070 Chromosome and associated proteins [BR:tch03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CHITON_2070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TFIID-31kDa TAF CENP-S Bromo_TP TFIID_20kDa TFIID-18kDa PE CENP-X DUF4923 PCP_red Bromo_TP_like Motif Other DBs NCBI-ProteinID:  CUX78849 UniProt:  A0A170SYI5 LinkDB All DBs Position I:1894550..1894753 Genome browser AA seq 67 aa AA seqDB search MGELPIAPVDRLIRKAGAERVSEEAAKILAEYLEEYAIEVSKKAVEFARHAGRKTVKAED IKLAIKS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggagagttaccaattgccccagttgacaggcttataaggaaggcaggtgccgagagg gtcagcgaggaggcagcaaagatcctcgctgagtacctcgaggagtacgcaattgaagtt tcaaagaaggctgtcgagtttgcaaggcacgccggaagaaagaccgtcaaggccgaggac atcaagctcgctatcaagagctga

DBGET integrated database retrieval system