Tatumella citrea: A7K98_07890
Help
Entry
A7K98_07890 CDS
T04873
Name
(GenBank) muramoyltetrapeptide carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
tci
Tatumella citrea
Brite
KEGG Orthology (KO) [BR:
tci00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
tci01002
]
A7K98_07890
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
tci01011
]
A7K98_07890
Enzymes [BR:
tci01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
A7K98_07890
Peptidases and inhibitors [BR:
tci01002
]
Serine peptidases
Family S66
A7K98_07890
Peptidoglycan biosynthesis and degradation proteins [BR:
tci01011
]
Precursor biosynthesis
Carboxypeptidase
A7K98_07890
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
ARU93704
UniProt:
A0A1Y0LI06
LinkDB
All DBs
Position
complement(1672427..1673365)
Genome browser
AA seq
312 aa
AA seq
DB search
MSASHTIRLIAPSGYCINQPAAERGVQFLLDAGHRLENESVIRRRFQRFAGTDEQRLSDI
NQLAHCPELPDIVLAVRGGYGASRLLSKIDYPALAESLAGQPVALCGHSDFTAIQLALLS
QCGLVTFSSPMLAGNFGASPPSEFTVQHFWKILGQKSYTIHWSGNTQKDFSAEGVLWGGN
LAMLASLIGTQWMPQVDNGILLIEDINEHPFRIERMLLQLWHAGILQRQQAVITGSFSGG
SLSDYDNGFNLDSVWQYMQEISGVPFIDGLQFGHEQETVTLPIGANARLESTGQQRSLKL
SGYPVLRPGTGE
NT seq
939 nt
NT seq
+upstream
nt +downstream
nt
atgtctgccagccatacgattcgactgatcgctccttcgggatactgcattaaccaaccg
gccgctgagcgcggtgtacagtttttactggatgccggtcaccggctggaaaacgaatct
gttattcgtcgccgttttcagcgtttcgccggaacagatgaacaacgactgtcagatatt
aatcagctggcacactgcccggaattaccggatattgtcctggctgtgcgtggtggctac
ggcgccagccgactactgtcaaaaatagattaccctgcgctggctgagagtctggccggt
caacccgtggcactgtgtggccacagcgatttcactgcaattcagctggcgctgttatca
caatgcgggttagtaacattcagttcaccgatgctggcaggcaattttggtgccagtccg
ccgtcggaatttactgtgcagcacttttggaaaattctcgggcaaaaaagttataccatc
cactggtcaggaaatacacaaaaagatttcagtgctgaaggcgtactgtggggcggaaat
ctggcaatgctggcatcgcttatcggtacccaatggatgccacaagtcgataatggaatt
ttgctgatcgaggacattaatgaacatcctttcagaattgaaagaatgttgttgcagttg
tggcatgcgggaattttgcaacgccagcaggcagtcattaccggcagcttcagtggtggt
tcattatctgactatgataatggttttaacctggactctgtctggcaatatatgcaggaa
atcagcggagtgccgtttattgatggtctgcaattcggccatgagcaggaaacagtcact
ctgccaattggtgcaaacgcccggctggaaagcactggccagcaacgttcactgaaactc
agcggttatccggtattacgcccaggaaccggagagtaa
DBGET
integrated database retrieval system