Tatumella citrea: A7K98_08110 Help Entry A7K98_08110       CDS       T04873                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tci  Tatumella citrea Pathway tci01100   Metabolic pathways tci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7K98_08110    00074 Mycolic acid biosynthesis     A7K98_08110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7K98_08110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARU93743 UniProt:  A0A1Y0L6V4 LinkDB All DBs Position 1719156..1719416 Genome browser AA seq 86 aa AA seqDB search MLNRDAVMNYILTCLQGIVEGGLEIKPDSDLVNDLGLESIRVLDLLMMLEDKLDISIPIN ILLDVRTPEQLLNALQPYLEKSNGSL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgacgctgtgatgaattatattctgacttgtctgcaaggtattgtcgaa ggcggattagaaattaaaccagatagcgatcttgtcaacgatctgggccttgaatccatc agagtattggatttgctgatgatgttggaagataaactggatatttctatcccgattaat attctgctggatgtcagaactcccgagcagctgttgaatgccctgcaaccttatctggag aaatcaaatgggtctttatga

DBGET integrated database retrieval system