Thauera chlorobenzoica: Tchl_0958 Help Entry Tchl_0958         CDS       T04612                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism tcl  Thauera chlorobenzoica Pathway tcl02024   Quorum sensing tcl03018   RNA degradation Brite KEGG Orthology (KO) [BR:tcl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Tchl_0958  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Tchl_0958  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tcl03019]     Tchl_0958    03036 Chromosome and associated proteins [BR:tcl03036]     Tchl_0958 Messenger RNA biogenesis [BR:tcl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Tchl_0958 Chromosome and associated proteins [BR:tcl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Tchl_0958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  APR03821 UniProt:  A0A1H5UAR9 LinkDB All DBs Position 996467..996703 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNTLRREHIPVSIYLVNGIKLQGQVESFDQYVVLLKNTVTQMVYKHAI STVVPARPVVIQQDEGSN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaacttctacaagaccccttcctcaacaccctgcgccgcgagcat attccggtgtcgatttacctggtcaatggcatcaagctgcagggccaggtcgagtcgttc gaccagtacgtcgtcctgttgaagaacaccgttacccagatggtgtacaagcacgcgatt tcgaccgtggttccggcccgtcccgtggtcatccagcaggacgagggcagcaactga

DBGET integrated database retrieval system