Thauera chlorobenzoica: Tchl_2391 Help Entry Tchl_2391         CDS       T04612                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tcl  Thauera chlorobenzoica Pathway tcl01100   Metabolic pathways tcl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tchl_2391    00074 Mycolic acid biosynthesis     Tchl_2391   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tchl_2391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  APR05229 UniProt:  A0A1H5RPD4 LinkDB All DBs Position 2591805..2592044 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagatcgaatcttcgttcgtcgatgatctgggcgcggattcgctggacacc gtggaactggtcatggccctggaagaggagttcgagtgcgagattccggacgaagaggcc gagaagatcaccaccgtccagcaggcgatcgactacgtcaacgcccacctcaagaagtaa

DBGET integrated database retrieval system