Thermodesulfobacterium commune: HL41_00165 Help Entry HL41_00165        CDS       T03212                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tcm  Thermodesulfobacterium commune Pathway tcm01100   Metabolic pathways tcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HL41_00165    00074 Mycolic acid biosynthesis     HL41_00165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HL41_00165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Homeodomain Motif Other DBs NCBI-ProteinID:  AIH03375 UniProt:  A0A075WQZ3 LinkDB All DBs Position 29398..29634 Genome browser AA seq 78 aa AA seqDB search MSIEEKVIDIIAQKLNLSKDQVKPEASFIEDLGADSLDLVELVMAMEEAFGMEVPDEDAE KLRTVQDVIDYVKAKVGN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctatagaagaaaaggtgattgacatcatcgctcaaaaacttaatctttctaaagat caggtcaaaccagaggcttcttttatcgaggacttaggggctgattcccttgatttggta gagcttgttatggctatggaagaggcctttggtatggaagtgcctgacgaggatgccgaa aagttaagaaccgtgcaggatgttatagactatgtaaaggccaaggtaggaaactaa

DBGET integrated database retrieval system