Thermomonas carbonis: H9L16_03265 Help Entry H9L16_03265       CDS       T06786                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism tcn  Thermomonas carbonis Pathway tcn00190   Oxidative phosphorylation tcn01100   Metabolic pathways Module tcn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tcn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     H9L16_03265 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tcn00194]     H9L16_03265 (atpE) Photosynthesis proteins [BR:tcn00194]  Photosystem and electron transport system   F-type ATPase [OT]    H9L16_03265 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNN70647 UniProt:  A0A7G9SS22 LinkDB All DBs Position complement(688728..689006) Genome browser AA seq 92 aa AA seqDB search MEALANVQAFTAIAIGIIVGLGALGAALGIGIMGSKFLESAARQPELVPMLQGRMFLLAG LIDAAFLIGVGVAMMFAFANPLLAAVQTAAGA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaagcacttgccaacgtccaggccttcaccgccatcgccatcggcatcatcgtcggc ctgggtgcgctcggcgccgccctcggcatcggcatcatgggctcgaagttcctcgaatcc gctgcccgccagccggaactggtcccgatgctgcagggccgcatgttcctgctcgccggc ctgatcgacgcggcgttcctgatcggcgtcggcgtggcgatgatgttcgcgttcgcgaac ccgctgctggccgccgtgcagaccgccgccggcgcctaa

DBGET integrated database retrieval system