Thermomonas carbonis: H9L16_07960 Help Entry H9L16_07960       CDS       T06786                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tcn  Thermomonas carbonis Brite KEGG Orthology (KO) [BR:tcn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tcn03036]     H9L16_07960 (ftsL) Chromosome and associated proteins [BR:tcn03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H9L16_07960 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QNN68694 UniProt:  A0A7G9SLG9 LinkDB All DBs Position 1732770..1733036 Genome browser AA seq 88 aa AA seqDB search MNGKLLLGALIAANVATALLVVRDRHEHRQAFVALSKLERARDEINIEFGRLQLEQATWA ESNRVDQVARSRLGMVFPRTEDIVVLRR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaagttgctgctgggcgcgctgatagcggccaacgtggccaccgcgctgctg gtcgtgcgcgatcgccacgagcaccgccaggctttcgtggcgctcagcaagctggagcgg gcgcgcgacgagatcaacatcgaattcggccgcttgcagctggagcaggcgacctgggcg gagagcaaccgcgtggaccaggtcgcgcgttcgcgcctgggcatggtgttcccgcgcacc gaagacatcgtggtgctgcgccgatga

DBGET integrated database retrieval system