Thermomonas carbonis: H9L16_13335 Help Entry H9L16_13335       CDS       T06786                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tcn  Thermomonas carbonis Pathway tcn01100   Metabolic pathways tcn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L16_13335    00074 Mycolic acid biosynthesis     H9L16_13335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L16_13335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNN71679 UniProt:  A0A7G9SV04 LinkDB All DBs Position complement(2869324..2869590) Genome browser AA seq 88 aa AA seqDB search MDTNSLEQDIKALIIATMSLEDVVADDIDADAPLFNEGLGLDSIDALELGLALQKRYGVT LAADSEETRRHFASVRSLAAFVATARAH NT seq 267 nt NT seq  +upstreamnt  +downstreamnt ctggacactaattcgctggaacaggacatcaaggcgctgatcatcgccacgatgtcgctg gaagacgttgtcgccgacgacatcgacgccgatgcgccgttgttcaacgaaggcctgggc ctggattcgatcgacgcactggaactcgggctggccctgcagaagcgttatggcgtgacc ctggccgccgattccgaggaaacccgccggcatttcgccagcgtgcgcagcctggccgcg ttcgtcgcgaccgcgcgcgcgcattga

DBGET integrated database retrieval system