KEGG   Thermobacillus composti: Theco_0716
Entry
Theco_0716        CDS       T02394                                 
Name
(GenBank) response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
tco  Thermobacillus composti
Pathway
tco02020  Two-component system
tco02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Theco_0716
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Theco_0716
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tco02022]
    Theco_0716
   02035 Bacterial motility proteins [BR:tco02035]
    Theco_0716
Two-component system [BR:tco02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Theco_0716
Bacterial motility proteins [BR:tco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Theco_0716
SSDB
Motif
Pfam: Response_reg B12-binding TadZ_N FtsJ RNase_H_2
Other DBs
NCBI-ProteinID: AGA56919
UniProt: L0EBC3
LinkDB
Position
748977..749336
AA seq 119 aa
MARIMVVDDAAFLRMMLKNILAQLGHEIVAEAANGEEAIRTYKQFKPDLVTMDITMPDMD
GIKVVEEIISFDPHAKIIMCSAMGSQNMVLDAIKVGAKDFIVKPFQNNRVMEAVTKVLG
NT seq 360 nt   +upstreamnt  +downstreamnt
atggccaggataatggttgttgatgatgcggcatttcttaggatgatgcttaagaacatt
cttgcccaactcggacatgaaattgttgctgaagccgcaaacggtgaagaagctatacga
acctataaacaatttaagcccgatcttgtaaccatggatattacgatgcctgatatggac
gggattaaggttgttgaagaaatcatttcttttgatccacatgcgaagatcatcatgtgc
agtgcaatggggagtcagaacatggtgttggacgctataaaagtaggagctaaagatttt
atagtcaagccttttcaaaataatcgagttatggaagccgtaaccaaggttcttggttaa

DBGET integrated database retrieval system