Thermobacillus composti: Theco_0716
Help
Entry
Theco_0716 CDS
T02394
Name
(GenBank) response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
tco
Thermobacillus composti
Pathway
tco02020
Two-component system
tco02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
tco00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Theco_0716
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
Theco_0716
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
tco02022
]
Theco_0716
02035 Bacterial motility proteins [BR:
tco02035
]
Theco_0716
Two-component system [BR:
tco02022
]
CheA family
CheA-CheYBV (chemotaxis)
Theco_0716
Bacterial motility proteins [BR:
tco02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
Theco_0716
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
B12-binding
TadZ_N
FtsJ
RNase_H_2
Motif
Other DBs
NCBI-ProteinID:
AGA56919
UniProt:
L0EBC3
LinkDB
All DBs
Position
748977..749336
Genome browser
AA seq
119 aa
AA seq
DB search
MARIMVVDDAAFLRMMLKNILAQLGHEIVAEAANGEEAIRTYKQFKPDLVTMDITMPDMD
GIKVVEEIISFDPHAKIIMCSAMGSQNMVLDAIKVGAKDFIVKPFQNNRVMEAVTKVLG
NT seq
360 nt
NT seq
+upstream
nt +downstream
nt
atggccaggataatggttgttgatgatgcggcatttcttaggatgatgcttaagaacatt
cttgcccaactcggacatgaaattgttgctgaagccgcaaacggtgaagaagctatacga
acctataaacaatttaagcccgatcttgtaaccatggatattacgatgcctgatatggac
gggattaaggttgttgaagaaatcatttcttttgatccacatgcgaagatcatcatgtgc
agtgcaatggggagtcagaacatggtgttggacgctataaaagtaggagctaaagatttt
atagtcaagccttttcaaaataatcgagttatggaagccgtaaccaaggttcttggttaa
DBGET
integrated database retrieval system