KEGG   Thermaerobacter composti: Q5761_12355
Entry
Q5761_12355       CDS       T09555                                 
Name
(GenBank) YidC/Oxa1 family membrane protein insertase
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
tcp  Thermaerobacter composti
Pathway
tcp02024  Quorum sensing
tcp03060  Protein export
tcp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tcp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Q5761_12355
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Q5761_12355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Q5761_12355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tcp03029]
    Q5761_12355
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tcp02044]
    Q5761_12355
Mitochondrial biogenesis [BR:tcp03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Q5761_12355
Secretion system [BR:tcp02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Q5761_12355
SSDB
Motif
Pfam: 60KD_IMP DUF2427
Other DBs
NCBI-ProteinID: WPD19111
UniProt: A0ABZ0QNP8
LinkDB
Position
complement(2998651..2999313)
AA seq 220 aa
MSQLWHWFVAAIEAGLEWSRAVTGSAGLSIILFTVLVRLLLLPLTFSQMRSMQRMQALQP
EVERIQKRYRNNPQKANEAIMKLWREHNVNPASGCLPLLIQFPILYGLFLALRTFSSGAF
LWIPDLRHADPYFVLPILAGVTTYVQMKTAMTVTQPQQRTMLVLMPLMLTFFAWSFPAGL
ALYWVTSNVFSIVQQIWMNRQQPAPAPAGKGKRGHERGIS
NT seq 663 nt   +upstreamnt  +downstreamnt
ttgagtcagctctggcattggttcgtggccgccatcgaggccgggctggagtggagccgg
gcggtgacgggcagcgccggcctgtccatcatcctgttcaccgtgctggtccggctcctg
ctcctgcccctgacgttctcccagatgcgctcgatgcagcggatgcaggcgctgcagccc
gaggtcgagcggatccagaagcggtaccggaacaacccccagaaggccaacgaggcgatc
atgaaactgtggcgggagcacaacgtgaaccccgcctcgggctgcctgccgttgctcatc
cagttccccatcctgtacgggctcttcctcgcgctgcgcaccttcagcagcggcgccttc
ctctggatcccggacctccgccatgcggatccgtacttcgtcctgccgatcctcgcgggc
gtgaccacgtacgtccagatgaagacggcgatgaccgtcacccagccccagcagcgcacg
atgctggtcctgatgccgctgatgctgaccttcttcgcgtggagcttccctgcggggctg
gcgctgtactgggtgaccagcaatgtgttctccatcgtgcagcagatctggatgaaccgg
cagcagcccgcgccggcgccggcgggaaaggggaagagagggcatgagcgcgggatctcc
tga

DBGET integrated database retrieval system