Thermococcus camini: TIRI35C_0476 Help Entry TIRI35C_0476      CDS       T07551                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tcq  Thermococcus camini Pathway tcq03010   Ribosome Brite KEGG Orthology (KO) [BR:tcq00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TIRI35C_0476 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TIRI35C_0476 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tcq03011]     TIRI35C_0476 (rpl40e)    04121 Ubiquitin system [BR:tcq04121]     TIRI35C_0476 (rpl40e) Ribosome [BR:tcq03011]  Ribosomal proteins   Eukaryotes    Large subunit     TIRI35C_0476 (rpl40e)   Archaea     TIRI35C_0476 (rpl40e) Ubiquitin system [BR:tcq04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TIRI35C_0476 (rpl40e) SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 DZR Zn_ribbon_RPAB4 Ribosomal_L40e Toxin_5 DZR_2 Zn_ribbon_3 Zn_ribbon_10 HVO_0416 HypA Motif Other DBs NCBI-ProteinID:  CAD5243630 UniProt:  A0A7G2D5M4 LinkDB All DBs Position TIRI35C:444790..444948 Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYVCMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagatttcccgaggctgaggccagaatctttaggaagtacgtgtgcatgcgctgc ggtgccactaacccgtggaaggccaagaagtgcaggaagtgcggctacaagggtctccgc ccgaaggcgagagagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system