Thermococcus camini: TIRI35C_0657 Help Entry TIRI35C_0657      CDS       T07551                                  Symbol hpkA Name (GenBank) Archaeal histone A   KO K24450   DNA-binding protein Organism tcq  Thermococcus camini Brite KEGG Orthology (KO) [BR:tcq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tcq03036]     TIRI35C_0657 (hpkA) Chromosome and associated proteins [BR:tcq03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     TIRI35C_0657 (hpkA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa CENP-S Bromo_TP TFIID-18kDa TFIID_20kDa CENP-X DUF1931 LonB_AAA-LID Motif Other DBs NCBI-ProteinID:  CAD5243811 UniProt:  A0A7G2D6C9 LinkDB All DBs Position TIRI35C:complement(620850..621053) Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEDAAKVLAEYLEEYAIELARKSADFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggccgagcttccgattgccccgattgacaggcttataaggaaggccggcgctgagagg gtcagcgaggacgctgccaaggttcttgccgagtacctcgaggagtacgccatcgagctt gccagaaagtccgccgactttgctaggcacgccggcaggaagaccgtcaaggccgaggac atcaagcttgccatcaaggcctga

DBGET integrated database retrieval system