Trypanosoma cruzi: 504109.24 Help Entry 504109.24         CDS       T01012                                  Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism tcr  Trypanosoma cruzi Pathway tcr04814   Motor proteins Brite KEGG Orthology (KO) [BR:tcr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     504109.24  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tcr03037]     504109.24    04812 Cytoskeleton proteins [BR:tcr04812]     504109.24 Cilium and associated proteins [BR:tcr03037]  Motile cilia and associated proteins   Dynein arm    504109.24 Cytoskeleton proteins [BR:tcr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      504109.24 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light MNR N_NLPC_P60 DUF7753 Motif Other DBs NCBI-GeneID:  3548785 NCBI-ProteinID:  XP_816849 UniProt:  Q4DR46 LinkDB All DBs AA seq 89 aa AA seqDB search MSDRKPNVKFADISEEMQNDAMTVATKAIKEHQMEKDIAAHIKKEFDKRYNPTWQCIAGR SFAADVVHESKHLIYFYVGQMSILLWKTG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccggaagccaaacgtgaagttcgcggacatcagcgaggagatgcagaatgac gcaatgacggtggccacgaaggcaattaaggagcaccaaatggaaaaggatatcgccgcc catataaagaaggagtttgacaagcgctacaatcccacctggcaatgcattgctggtcga agctttgctgctgacgttgttcacgaaagcaagcaccttatttatttttatgttggtcag atgtcaattcttttgtggaagacgggctga

DBGET integrated database retrieval system