Trypanosoma cruzi: 507093.44 Help Entry 507093.44         CDS       T01012                                  Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism tcr  Trypanosoma cruzi Pathway tcr04814   Motor proteins Brite KEGG Orthology (KO) [BR:tcr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     507093.44  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tcr03037]     507093.44    04812 Cytoskeleton proteins [BR:tcr04812]     507093.44 Cilium and associated proteins [BR:tcr03037]  Motile cilia and associated proteins   Dynein arm    507093.44 Cytoskeleton proteins [BR:tcr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      507093.44 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light MNR N_NLPC_P60 DUF7753 Motif Other DBs NCBI-GeneID:  3553265 NCBI-ProteinID:  XP_820537 UniProt:  Q4E1Q6 LinkDB All DBs AA seq 89 aa AA seqDB search MSDRKPNVKFADISEEMQNDAMTVATKAIKEHQMEKDIAAHIKKEFDKRYNPTWQCIAGR SFAADVVHESKHLIYFYIGQMSILLWKTG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccggaagccaaacgtgaagttcgcggacatcagcgaggagatgcagaatgac gcaatgacggtggccacgaaggcaattaaggagcaccaaatggaaaaggatattgccgcc catataaagaaggagtttgacaagcgctacaatcccacctggcaatgcattgctggtcga agctttgctgctgacgttgttcacgaaagcaagcaccttatttatttttatattggtcag atgtcaattcttttgtggaagacgggctga

DBGET integrated database retrieval system