Trypanosoma cruzi: 508355.104 Help Entry 508355.104        CDS       T01012                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism tcr  Trypanosoma cruzi Pathway tcr03020   RNA polymerase tcr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tcr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     508355.104   09124 Replication and repair    03420 Nucleotide excision repair     508355.104  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tcr03021]     508355.104    03400 DNA repair and recombination proteins [BR:tcr03400]     508355.104 Transcription machinery [BR:tcr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      508355.104 DNA repair and recombination proteins [BR:tcr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       508355.104 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  3553933 NCBI-ProteinID:  XP_821132 UniProt:  Q4E3C1 LinkDB All DBs AA seq 133 aa AA seqDB search MMSIPHGMLIYNNDITADSLVDTKGTRKITEEISSKMPNSSLFKLDKEDHTLANLLRMKL HEDALVHIAGYRVPHPTQHRVELRVQTSSDGSGRPIPSPKDALLKAIDACMQDLQSFEEQ LRWEAQSKGISTE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgatgtcaattcctcatggtatgttgatctacaacaatgatatcacagccgatagctta gtagacaccaaaggcactcgcaagataaccgaggaaatctcaagcaagatgccaaattct tcactctttaaactggataaggaggatcacacattagctaatcttctccgcatgaaactg catgaggatgcgctggtgcatattgcgggctatcgtgttccccacccgacgcagcaccgc gtagaacttcgtgtgcaaacttcatctgacggatcaggtcgccccattccttccccgaag gatgctttattgaaggcgattgatgcatgcatgcaagatcttcaaagctttgaagagcaa ctccgctgggaggcacagtcaaagggcatcagtacggaataa

DBGET integrated database retrieval system