Trypanosoma cruzi: 510761.73 Help Entry 510761.73         CDS       T01012                                  Name (RefSeq) dynein-associated protein   KO K10419   dynein light chain roadblock-type Organism tcr  Trypanosoma cruzi Pathway tcr04814   Motor proteins Brite KEGG Orthology (KO) [BR:tcr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     510761.73  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tcr04131]     510761.73   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tcr03037]     510761.73    04812 Cytoskeleton proteins [BR:tcr04812]     510761.73 Membrane trafficking [BR:tcr04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     510761.73 Cilium and associated proteins [BR:tcr03037]  Motile cilia and associated proteins   Dynein arm    510761.73 Cytoskeleton proteins [BR:tcr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      510761.73 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Ras CRM1_repeat_2 Motif Other DBs NCBI-GeneID:  3544697 NCBI-ProteinID:  XP_813346 UniProt:  Q4DG38 LinkDB All DBs AA seq 98 aa AA seqDB search MSEIEETFQRISQRPNVTGIIVVNNEGVPIRSTIEDTVTQNQYAHLITALAAKARHCVRD LDPTNDLSFLRIRSKKNEIMVAPDKDFTLIVIQRFSDM NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgagattgaggaaacatttcagcgtattagccagcgaccgaacgtgacgggtata atagttgtgaacaatgagggtgttcccataagaagcaccattgaagatactgtaacacag aaccagtatgcgcatctgatcacggcattagctgcaaaagctcgtcattgtgtgagggac ttggatccgacaaatgatctttcctttttacgtataaggagcaaaaagaatgaaattatg gtggccccggacaaggattttacgcttattgttattcagcgattttcggatatgtaa

DBGET integrated database retrieval system