Trypanosoma cruzi: 511367.74 Help Entry 511367.74         CDS       T01012                                  Name (RefSeq) hypothetical protein   KO K08499   member of the syntaxin family of t-SNAREs Organism tcr  Trypanosoma cruzi Pathway tcr04130   SNARE interactions in vesicular transport Brite KEGG Orthology (KO) [BR:tcr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     511367.74  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tcr04131]     511367.74 Membrane trafficking [BR:tcr04131]  SNARE   SNAP-25[C] (Qc)    STX6     511367.74 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNF152_C DUF7776 Motif Other DBs NCBI-GeneID:  3551879 NCBI-ProteinID:  XP_819441 UniProt:  Q4DYI4 LinkDB All DBs AA seq 96 aa AA seqDB search MNRQIQHDDHITEQNKLLDQLHSSVMNTRHYAVSIGDDLREQDGMLDGLHSGVTLAADES RRQNSNVMRLLKESEEKGFCVAVIVLVLIMFLLLVI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaggcaaatccagcacgatgatcacatcacagaacagaataaactgcttgatcag cttcattcctcagttatgaatacacgccactatgccgtgtccatcggtgacgaccttcgc gagcaggatggcatgttggatggccttcactctggagtgacactcgcagcggatgagagc cgccgccaaaacagcaatgtcatgcggctgctgaaggaaagcgaagagaagggcttctgt gtagctgtcattgtgctggtgttgatcatgttcctgcttttagtcatttag

DBGET integrated database retrieval system