Thermosphaera chiliense: IMZ38_00535 Help Entry IMZ38_00535       CDS       T10865                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tcs  Thermosphaera chiliense Pathway tcs03010   Ribosome Brite KEGG Orthology (KO) [BR:tcs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     IMZ38_00535   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     IMZ38_00535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tcs03011]     IMZ38_00535    04121 Ubiquitin system [BR:tcs04121]     IMZ38_00535   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tcs04147]     IMZ38_00535 Ribosome [BR:tcs03011]  Ribosomal proteins   Eukaryotes    Small subunit     IMZ38_00535   Archaea     IMZ38_00535 Ubiquitin system [BR:tcs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    IMZ38_00535 Exosome [BR:tcs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    IMZ38_00535   Exosomal proteins of colorectal cancer cells    IMZ38_00535 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_ribbon_PriA Phage_zn_bind_2 TackOD1 Zn_ribbon_3 Lar_restr_allev Ribosomal_L37ae Zn_Ribbon_1 EDR4-like_1st DUF7479 Zn_ribbon_recom DUF1451 zf_UBZ DUF6758 Motif Other DBs NCBI-ProteinID:  QOR94477 UniProt:  A0A7M1USG8 LinkDB All DBs Position 86259..86420 Genome browser AA seq 53 aa AA seqDB search MPYVHKLYEVDYKTGKLVRKNKSCPKCGSFMAFHKQPVPRWHCGRCGYVEYAK NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgccctatgttcacaagctctacgaagtggattacaagacggggaagctggtgaggaag aacaagtcatgccctaaatgcggctccttcatggctttccacaagcaaccagtccctaga tggcactgcgggagatgcggctacgtcgagtacgcgaagtag

DBGET integrated database retrieval system