Thermosphaera chiliense: IMZ38_00535 Help Entry IMZ38_00535       CDS       T10865                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tcs  Thermosphaera chiliense Pathway tcs03010   Ribosome Brite Ribosome [BR:tcs03011]  Ribosomal proteins   Eukaryotes    Small subunit     IMZ38_00535   Archaea     IMZ38_00535 Ubiquitin system [BR:tcs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    IMZ38_00535 Exosome [BR:tcs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    IMZ38_00535   Exosomal proteins of colorectal cancer cells    IMZ38_00535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QOR94477 UniProt:  A0A7M1USG8 LinkDB All DBs Position 86259..86420 Genome browser AA seq 53 aa AA seqDB search MPYVHKLYEVDYKTGKLVRKNKSCPKCGSFMAFHKQPVPRWHCGRCGYVEYAK NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgccctatgttcacaagctctacgaagtggattacaagacggggaagctggtgaggaag aacaagtcatgccctaaatgcggctccttcatggctttccacaagcaaccagtccctaga tggcactgcgggagatgcggctacgtcgagtacgcgaagtag

DBGET integrated database retrieval system